General Information

  • ID:  hor006551
  • Uniprot ID:  P55246
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIKMMDTGGVVVLPEETSAHVSERLRPYDVILKKWMPHK
  • Length:  46(29-74)
  • Propeptide:  VQVVVLALVAQVTLSQHWSYGWLPGGKRSVGELEATIKMMDTGGVVVLPEETSAHVSERLRPYDVILKKWMPHK
  • Signal peptide:  VQVVVLALVAQVTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55246-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006551_AF2.pdbhor006551_ESM.pdb

Physical Information

Mass: 598189 Formula: C230H375N61O68S3
Absent amino acids: CFNQ Common amino acids: V
pI: 6.51 Basic residues: 8
Polar residues: 10 Hydrophobic residues: 15
Hydrophobicity: -20.65 Boman Index: -6132
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 93.04
Instability Index: 6158.7 Extinction Coefficient cystines: 6990
Absorbance 280nm: 155.33

Literature

  • PubMed ID:  1308825
  • Title:  Fish gonadotropin-releasing hormone gene and molecular approaches for control of sexual maturation: development of a transgenic fish model.